<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-4003 4003-1993 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 171
2 3TC+ AZT 22
3 3TC+ D4T 16
4 3TC+ SQV 38
5 3TC+ DDC+ NFV+ NVP 24
6 3TC+ DDI+ EFV+ NFV 32
7 3TC+ D4T 18
8 3TC 2
9 3TC+ DDI+ EFV+ NFV 10

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y     V179D K103R, V118I, D121H, K122E, A158S, F214L, A272P  
>4003-1993| codons 22-273
KQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELN
KRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSIPLHEDFRKYTAFTIPSINNETPG
IRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIDIYQYVDDLYVGSDLEIGQHRTK
IEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLV
GKLNWASQIYPG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, D60X, I64V, I72M, T74A  
>4003-1993| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYE
QILVEICGHKAMGAVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005