<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-3927 3927-1960 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 34
2 NRTI 137
3 3TC+ RTV+ SQV 61
4 D4T+ NVP+ RTV+ SQV 42
5 3TC+ NVP+ D4T 24
6 NVP+ D4T 11
7 NVP+ D4T+ 3TC 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y K219N Y181V   K32X, E44D, V118I, D123E, I135T, V179I, E203K, Q207E, H208Y, R211K, K223Q, L228R, Q269X, A272P  
>3927-1960| codons 22-273
KQWPLTEEKIXALVEICTELEKDGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELN
KRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSTNNETPG
IRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIIIVQYVDDLYVGSDLEIGQHRTK
IKELREYLWKWGFYTPDNKHQQEPPFRWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLV
GKLNWASHIYPG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005