<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-3714 3714-4653 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 8
2 AZT+ 3TC+ RTV 10
3 AZT+ 3TC+ RTV+ IDV 34
4 3TC+ RTV+ IDV+ SQV+ D4T 15
5 RTV+ IDV+ SQV+ D4T 15
6 DDI+ NFV+ NVP+ IDV 18
7 3TC+ AZT+ IDV 3
8 3TC+ SQV+ D4T 44
9 EFV+ NFV+ DDI 28
10 ABC+ APV+ D4T 4
11 3TC+ APV+ D4T 48
12 3TC+ RTV+ SQV+ DDI 24
13 3TC+ D4T 4
14 3TC+ D4T+ EFV+ APV 18
15 3TC+ D4T+ EFV+ APV+ DDI 7
16 3TC+ D4T+ EFV+ APV 11
17 3TC+ EFV+ APV 16
18 3TC+ EFV+ APV+ TDF 1

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, L210W, T215Y   L100I, K103N, Y181I   E44D, V118I, K122E, I135V, E138G, S162C, I178M, V179I, V189I, T200A, E203K, Q207E, R211K, K223Q  
>3714-4653| codons 21-260
VKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKVVDFREL
NKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSVNNGTP
GIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDMIIIQYVDDLYIGSDLEIGQHRA
KIKELREHLWKWGFYTPDKKHQQEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50V, I54V, L90M G73T, L89V L10I, K20R, E35D, M36I, L63P, G68E, H69K, A71I, I93L  
>3714-4653| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGVGGFVKVRQYD
QIPIEICEKKIITTVLVGPTPVNIIGRNVMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003