<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-3714 3714-3118 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 8
2 AZT+ 3TC+ RTV 10
3 AZT+ 3TC+ RTV+ IDV 34
4 3TC+ RTV+ IDV+ SQV+ D4T 15
5 RTV+ IDV+ SQV+ D4T 15
6 DDI+ NFV+ NVP+ IDV 18
7 3TC+ AZT+ IDV 3
8 3TC+ SQV+ D4T 44
9 EFV+ NFV+ DDI 28
10 ABC+ APV+ D4T 4
11 3TC+ APV+ D4T 40

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, L210W, T215Y   Y181I V108I I37F, E44D, V118I, K122E, I135V, E138G, S162C, I178M, V179I, V189I, T200A, Q207E, R211K  
>3714-3118| codons 21-260
VKQWPLTEEKIKALVEFCTELEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKVVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSIPLDEDFRKYTAFTIPSVNNGTP
GIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDMIIIQYVDDLYIGSDLEIGQHRA
KIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50V, I54V, L90M G73T, L89V L10I, K20R, E35D, M36I, L63P, H69K, A71I, I93L  
>3714-3118| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGVGGFVKVRQYD
QIPIEICGKKIITTVLVGPTPVNIIGRNVMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005