<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-3714 3714-1999 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 8
2 AZT+ 3TC+ RTV 10
3 AZT+ 3TC+ RTV+ IDV 34
4 3TC+ RTV+ IDV+ SQV+ D4T 15
5 RTV+ IDV+ SQV+ D4T 15
6 DDI+ NFV+ NVP+ IDV 18
7 3TC+ AZT+ IDV 3
8 3TC+ SQV+ D4T 44
9 EFV+ NFV+ DDI 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, L210W, T215Y   L100I, K103N, Y181I   E36X, E44D, K122E, I135V, E138G, S162C, I178M, V179I, V189I, T200A, Q207E, R211K, A272P  
>3714-1999| codons 22-274
KQWPLTEEKIKALVDICTELEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKVVDFRELN
KRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNGTPG
IRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDMIIIQYVDDLYIGSDLEIGQHRAK
IEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLV
GKLNWASQIYPGI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M G73T L10I, K20R, E35D, M36I, L63P, H69K, A71I, I93L  
>3714-1999| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGKKIITTVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005