<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-3714 3714-1209 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 8
2 AZT+ 3TC+ RTV 10
3 AZT+ 3TC+ RTV+ IDV 34
4 3TC+ RTV+ IDV+ SQV+ D4T 15
5 RTV+ IDV+ SQV+ D4T 15
6 DDI+ NFV+ NVP+ IDV 18
7 3TC+ AZT+ IDV 3
8 3TC+ SQV+ D4T 9

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M G73S L10I, K20R, E35D, M36I, L63P, H69K, A71I, I72X, I93L  
>3714-1209| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGKKIMSTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, L210W, T215Y   K103N, Y181C V108I E44D, K122E, I135V, S162C, I178M, V189I, T200A, Q207E, R211K  
>3714-1209| codons 22-271
KQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKVVDFRELN
KRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPG
IRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDMVICQYVDDLYIGSDLEIGQHRAK
IEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLV
GKLNWASQIY

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005