<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-3395 3395-3931 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 6
2 NRTI 24
3 3TC+ AZT+ IDV 51
4 D4T+ RTV+ SQV 30
5 D4T+ DDI+ NFV+ NVP 4
6 3TC+ D4T+ DDI+ NFV 42
7 DDI+ NFV+ D4T+ 3TC 110
8 NFV+ D4T+ 3TC 9

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F, L90M   L10I, L19I, E35D, M36MI, N37D, L63P, I64V, V77I, I93L  
>3395-3931| codons 1-93
PQITLWQRPIVTIKIGGQIKEALLDTGADDTVLEDIDLPGRWKPKIIGGIGGFVKVRQYD
QIPVEICGHKAIGTVLIGPTPFNIIGRNLMTQL

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       T27X, K43E, T165L, I178M, R211K, V245Q  
>3395-3931| codons 21-260
VKQWPLXEEKIKALVEICTELEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETP
GIRYQYNVLPQGWKGSPAIFQSSMLKILEPFRKQNPDMVIYQYVDDLYVGSDLEIGQHRT
KIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPEKDSWTVNDIQKL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005