<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-3386 3386-2188 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ RTV 42
2 RTV 13
3 NVP+ RTV+ SQV 7
4 RTV+ SQV 1
5 RTV 5
6 Unknown 61
7 ABC+ EFV 15

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V   Y181C, G190A A98G, V179D, P225H A158S, T165I, T200V  
>3386-2188| codons 21-260
VKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFREL
NKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETP
GIRYQYNVLPQGWKGSPSIFQSSMIKILEPFRKQNPDIDICQYMDDLYVASDLEIGQHRV
KIEELRQHLLRWGFTTPDKKHQKEHPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005