<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-2909 2909-3897 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 11
2 3TC+ AZT+ IDV 80
3 3TC+ AZT+ NFV 108
4 NFV 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, L90LM L10FV, N88D I13V, E35D, M36I, L63P, I64V, A71AV  
>2909-3897| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADNTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGHKVIGTVLVGPTPVNIIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       T39A, K43E, K122E, I142V, S162C, L228H  
>2909-3897| codons 21-260
VKQWPLTEEKIKALVEICAELEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETP
GVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRT
KIEELRQHLWRWGFYTPDKKHQKEPPFHWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005