<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-2909 2909-2250 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 11
2 3TC+ AZT+ IDV 80
3 3TC+ AZT+ NFV 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   I13V, L63P, I64V  
>2909-2250| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, L210W, T215Y       T39A, E40A, K43E, S162C, D218E  
>2909-2250| codons 21-233
VKQWPLTEEKIKALVEICAAMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETP
GIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRT
KIEELRQHLWRWGFYTPEKKHQKEPPFLWMGYE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005