<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-2826 2826-3900 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 20
2 NFV+ NVP+ D4T 49
3 NFV+ NVP+ D4T+ RTV+ DDI+ SQV+ 3TC 3
4 RTV+ DDI+ SQV+ 3TC 8
5 DDI+ SQV+ 3TC 4
6 SQV+ 3TC 1
7 3TC 32
8 RTV+ 3TC+ SQV+ DDI 13
9 3TC+ SQV+ DDI 1
10 SQV+ DDI 3
11 DDI 4
12 APV+ ABC+ 3TC+ AZT 8
13 ABC+ 3TC+ AZT 26
14 ABC+ 3TC+ AZT+ RTV+ APV 17
15 RTV+ APV 7
16 APV 2

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210LW, T215F K219Q   A98G K122E, I135T, I202V, D218E, V245K  
>2826-3900| codons 23-260
QWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNK
RTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGI
RYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKV
EELRQHLWRWGFFTPEQKHQKEPPFLWMGYELHPDKWTVQPIKLPEKDSWTVNDIQKL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, L90M G73S L10I, I13V, N37ND, R41K, L63P, V77I  
>2826-3900| codons 1-92
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMDLPGKWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAISTVLIGPTPVNIIGRNLMTQ

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005