<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-2826 2826-1791 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 20
2 NFV+ NVP+ D4T 49
3 NFV+ NVP+ D4T+ RTV+ DDI+ SQV+ 3TC 3
4 RTV+ DDI+ SQV+ 3TC 8
5 DDI+ SQV+ 3TC 3

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184I, T215F K219Q Y181C A98G K122E, I135T, I202V, H208Y, D218E  
>2826-1791| codons 22-226
KQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELN
KRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPG
IRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYIDDLYVGSDLEIGQHRTK
VEELRQYLLRWGFFTPEQKHQKEPP

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005