<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-2620 2620-3080 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 11
2 3TC+ AZT 27
3 3TC+ D4T+ IDV 24
4 3TC+ DDC+ IDV 27
5 RTV+ SQV 16
6 DDI+ NFV+ NVP 68
7 DDI+ NFV+ NVP 12
8 NFV+ NVP 1
9 NVP 3
10 D4T+ APV+ ABC 45

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A F53L L10I, K20R, M36I, L63S, I64V, E65D, A71V  
>2620-3080| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTILEEINLPGRWKPKIIGGIGGLIKVRQYD
QISVDICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, Y115F, L210W, T215Y   K103KN, Y181C, G190A   I31L, V35M, T39A, R83K, D123E, D177E, T200R, L228R  
>2620-3080| codons 30-260
KLKALMEICAELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKKTQDFWE
VQLGIPHPAGLKKNKSVTVLDVGDAFFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRKQNPEIVICQYMDDLYVASDLEIGQHRRKIEELRQHL
WRWGFYTPDKKHQKEPPFRWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005