<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-2551 2551-3137 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 3TC+ NFV+ D4T 24
3 DDI+ ABC+ APV 37
4 ABC+ APV 1
5 ABC+ APV+ 3TC+ AZT 6

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, L90M L33LF, G73S L10I, K20R, E35D, M36I, N37T, I62V, L63P, A71V  
>2551-3137| codons 1-92
PQITLWQRPIVTIKIGGQLREALLDTGADDTVFEDITLPGRWKPKMIGGIGGFLKVRQYD
QVPIEICGHKVISTVLVGPTPVNIIGRNLMTQ

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q     V60I, I135L, G196E, T200A, I202V, R211RK, V245K  
>2551-3137| codons 32-260
KALVEICTEMEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQ
LGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSLNNETPGIRYQYNVLPQ
GWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRAKVEELRQHLLK
WGFFTPDQKHQKEPPFLWMGYELHPDKWTVQPIKLPEKDSWTVNDIQKL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005