<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-2551 2551-2223 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 3TC+ NFV+ D4T 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L10I, K20R, E35D, M36I, L63P, A71V, V77I, Q92X, I93L  
>2551-2223| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVISTVLIGPTPVNIIGRNLMTXLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q     V60I, I135L, G196E, T200A, I202V, R211K, V245K, A272P  
>2551-2223| codons 23-273
QWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNK
RTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSLNNETPGI
RYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRAKV
EELRQHLLKWGFFTPDQKHQKEPPFLWMGYELHPDKWTVQPIKLPEKDSWTVNDIQKLVG
KLNWASQIYPG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005