<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-2224 2224-3386 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 222
2 DDC 42
3 D4T 12
4 3TC+ AZT 32
5 3TC+ AZT+ SQV 12
6 3TC+ AZT+ IDV 25
7 3TC 2
8 3TC+ NFV+ D4T 1
9 D4T+ NFV 3
10 RTV+ SQV 22
11 DDI+ NFV+ NVP 11
12 3TC+ AZT+ IDV 87
13 ABC+ D4T+ APV 1
14 ABC+ D4T+ APV+ DDI 1
15 D4T+ APV+ DDI 8
16 APV 2
17 APV+ 3TC+ AZT 35

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73GA L10I, L63P, A71V, V77VI, P79X, I93L  
>2224-3386| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVIATVLIGXTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y D67G, K219N     K43Q, E44D, S68G, V118I, I135T, I178M, H208F, R211Q, D218E, V245E  
>2224-3386| codons 32-260
KALVEICTELEQDGKISKIGPENPYNTPVFAIKKKGGTKWRKIVDFRELNKRTQDFWEVQ
LGIPHPAGLKKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQ
GWKGSPAIFQSSMTKILEPFRKQNPDMVIYQYVDDLYVGSDLEIGQHRTKIEELRQFLWQ
WGFYTPENKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTVNDIQKL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005