<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-2224 2224-2475 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 222
2 DDC 42
3 D4T 12
4 3TC+ AZT 32
5 3TC+ AZT+ SQV 12
6 3TC+ AZT+ IDV 25
7 3TC 2
8 3TC+ NFV+ D4T 1
9 D4T+ NFV 3
10 RTV+ SQV 22
11 DDI+ NFV+ NVP 11
12 3TC+ AZT+ IDV 87

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84IV, L90M G73S L10I, L63P, A71V, V77I, P79PA, I93L  
>2224-2475| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVISTVLIGATPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y D67DG, K219N     S68G, I135T, I178M, H208HY, R211Q, V245E  
>2224-2475| codons 30-260
KIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKGGTKWRKIVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRKQNPDMVIYQYVDDLYVGSDLEIGQHRTKIEELRQYL
WQWGFYTPDNKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTVNDIQKL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005