<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-1640 1640-2222 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ SQV 8
2 D4T+ NVP+ RTV+ SQV 26
3 SQV 4
4 DDI+ NFV+ ABC 12
5 DDI+ NFV+ ABC 5

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M   K43R, I62V, L63P, A71T, I93L  
>1640-2222| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWRPKIIGGIGGFVKVRQYD
QVPIEICGHKTIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   K103N   K122E, S162C, E169D, I178L, Q207E, R211K, A272P  
>1640-2222| codons 41-273
LEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QCSMTKILDPFRKQNPDLVIYQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKK
HQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005