<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-0958 0958-2850 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 56
2 AZT+ DDC 39
3 3TC 71
4 3TC+ D4T+ DLV+ IDV 40
5 3TC 3
6 DDI+ NFV+ NVP 45
7 NVP 1
8 ABC+ EFV+ 3TC 19
9 APV+ DLV+ D4T 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54M, L90M   T12S, K20I, E35D, M36I, I62V, L63P, A71AV, I72L  
>0958-2850| codons 1-99
PQITLWQRPLVSIKIGGQLIEALLDTGADDTVLEDINLPGRWKPKLIGGIGGFMKVRQYD
QVPIEICGHKVLGTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   K103N   S68G, I135T, I178M, R211K, L228H, A272P  
>0958-2850| codons 21-273
VKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETP
GIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVIYQYMDDLYVGSDLEIGQHRT
KIEELRQHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKL
VGKLNWASQIYPG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005