<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-0958 0958-2144 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 56
2 AZT+ DDC 39
3 3TC 71
4 3TC+ D4T+ DLV+ IDV 40
5 3TC 3
6 DDI+ NFV+ NVP 45
7 NVP 1
8 ABC+ EFV+ 3TC 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   K103N, Y181C   K43Q, S68G, V118I, I135T, L168X, I178M, V189I, R211K  
>0958-2144| codons 22-227
KQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPVFAIKKKDGTKWRKVVDFRELN
KRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSTNNETPG
IRYQYNVLPQGWKGSPAIFQSSMTKIXEPFRKQNPDMVICQYVDDLYIGSDLEIGQHRTK
IEELRQHLWKWGFYTPDKKHQKEPPF

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L90M   T12S, K20I, E35D, I62V, L63P, A71V, I72L, Q92X  
>0958-2144| codons 1-99
PQITLWQRPLVSIKIGGQLIEALLDTGADDTVLEDMNLPGRWKPKLIGGIGGFIKVRQYD
QVPIEICGHKVLGTVLVGPTPVNIIGRNLMTHIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005