<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-0835 0835-2529 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ IDV 27
2 D4T 4
3 D4T+ DLV+ NFV 66
4 Unknown NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63C, V77I, I93L  
>0835-2529| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QICIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181YC   D123E, I142IV, Q207QH, L210LF, R211K, A272P T253TI
>0835-2529| codons 21-273
VKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETP
GVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRT
KIEELRHHLFKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWIVNDIQKL
VGKLNWASQIYPG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005