<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-0503 0503-2964 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 82
2 NRTI 132
3 AZT+ DDC 20
4 AZT+ DDI 9
5 3TC+ AZT+ RTV 60
6 3TC+ D4T+ SQV 8
7 3TC+ IDV+ NVP 66
8 3TC+ AZT+ NFV 48
9 NFV 4
10 EFV+ ABC+ APV+ RTV 3
11 EFV+ ABC+ APV+ RTV+ D4T 30

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T215Y   K103N A98G V35I, K43E, V60I, R83K, K122E, D218E  
>0503-2964| codons 21-260
VKQWPLTEEKIKALIEICTELEEEGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFREL
NKKTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETP
GIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRT
KIEELRQHLLRWGFYTPEKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M   L10I, K20R, E35D, M36I, N37S, R41K, D60E, I62V, L63P, A71T, V77I, Q92X, I93L  
>0503-2964| codons 1-94
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDISLPGKWKPKMIGGIGGFVKVRQYE
QVPIEICGHKTIGTVLIGPTPVNVIGRNLMTHLG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005