<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-0233 0233-2198 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ EFV+ NFV 12
2 NFV 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, L210W, T215Y   L100I, K103N   K43N, K122E, D123E, V189I, I202V, Q207G, R211K, L228Q, A272P  
>0233-2198| codons 29-273
EKIKALVEICTELENEGKISKIGPENPYNTPVFAIKKKNSDKWRKVVDFRELNKRTQDFW
EVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYIGSDLEIGQHRTKVEELRGH
LWKWGFYTPDKKHQKEPPFQWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWAS
QIYPG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, L90M   L10V, K20R, M36I, L63P, A71V, I72V, I93L  
>0233-2198| codons 1-99
PQITLWQRPVVTIKIGGQLREALLDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYD
QIPIEICGHKVVGTVLVGPTPTNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005