<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-0211 0211-3134 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 39
2 AZT+ DDC 17
3 D4T 21
4 3TC+ D4T+ IDV 126
5 D4T 1
6 D4T+ DDI+ NFV 45
7 D4T+ NFV 1
8 D4T 3
9 D4T+ ABC+ APV+ 3TC 4
10 D4T+ APV+ 3TC 11
11 D4T+ APV+ 3TC 10
12 D4T+ APV+ 3TC 20

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y       A33S, V35L, T39A, E40F, K43E, V118I, K122E, Q207E, H208Y, R211K, V245E  
>0211-3134| codons 32-260
KSLLEICAFLEEEGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQ
LGIPHPAGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQ
GWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELREYLWK
WGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTVNDIQKL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I, L33F L10I, K20R, M36I, I62V, L63P, I66F, A71V  
>0211-3134| codons 1-99
PQITLWQRPIVTIKIGGQLREALIDTGADDTVFEEINLPGRWKPKLIGGIGGFVKVRQYD
QVPIEFCGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003