<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-0211 0211-2209 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 39
2 AZT+ DDC 17
3 D4T 21
4 3TC+ D4T+ IDV 126
5 D4T 1
6 D4T+ DDI+ NFV 45

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82T L24I L10I, K20R, M36I, I62V, L63P, I66F, A71V, Q92X  
>0211-2209| codons 1-99
PQITLWQRPIVTIKIGGQLREALIDTGADDTVLEEINLPGRWKPKLIGGIGGFVKVRQYD
QVPIEFCGHKVIGTVLVGPTPTNIIGRNLLTHIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005