<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3008879 3008879 U.K. 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ D4T+ DDI 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R K219Q Y181C   T27S, V35T, T39E, S48T, V60I, D121H, K122E, I135IR, K166R, K173T, D177E, T200A, I202V, Q207E, H221Y, V245Q, A272P, K277R, T286A, E291D, V292I, I293V T139TP
>3008879| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALTEICEEMEKEGKITKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSRNNEPPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRTQNPEIVI
CQYMDDLYVGSDLEIGQHRAKVEELREHLLRWGFTTPDQKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, M36I, N37Q, R41K, L63S, H69K, L89M, I93L  
>3008879| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEIQLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005