<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
89M2626 89M2626 U.K. 2001 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT 261
2 SQV+ 3TC+ D4T 108
3 DDC+ NFV+ NVP 17
4 RTV+ DDI+ D4T+ SQV 47
5 SQV+ RTV+ DDI+ AZT 89

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M F53L, L89V L10I, I13V, K14R, K20I, E35D, M36I, N37E, R41K, R57K, H69K, A71V, T74S  
>89M2626| codons 1-99
PQITLWQRPIVTVRIGGQLIEALLDTGADDTVLEDIELPGKWKPKMIGGIGGLVKVKQYD
QILIEICGKKVIGSVLVGPTPVNIIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215I, K219E K103N L234LI E6D, V35T, T39M, V60I, K122E, D123S, I135T, K173S, Q174K, V179IT, T200A, Q207A, R211S, D218DE, T286A, E291D, I293V, P294T, I329V  
>89M2626| codons 1-335
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPDIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFITPEEKHQKEPPFLWMGYEIHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQG

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005