<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
01M6122 01M6122 U.K. 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ NFV+ 3TC 224

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V       E6D, V35T, V60I, T69S, D121Y, K122E, K173A, Q174K, D177E, V179I, Q207A, R211S, F214L, V245T, P247T, D250E, A272P, K277R, L282C, T286A, I293V, E297A  
>01M6122| codons 1-324
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSSRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIII
YQYVDDLYVGSDLEIGQHRTKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLTEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCLRGAKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S L10F I13V, K20I, E35D, M36I, R41K, H69K, L89M  
>01M6122| codons 1-99
PQITLWQRPFVTVKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRSMLTQIGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005