<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M41984 M41984 U.K. 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT 43
2 None 168
3 D4T+ 3TC+ IDV 139
4 DDI+ EFV+ AZT+ 3TC 137

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, V75M, M184V, L210W, T215Y K219E K103N, Y181C V108I V35T, V60I, K122E, D123S, I135T, K173S, Q174K, V179I, T200A, E203K, Q207D, R211K, D218E, H221Y, L228H, V245Q, D250E, A272T, E291D, V292I, I293V  
>M41984| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPDIII
CQYVDDLYVGSDLEIGQHRAKIKELRDHLWKWGFYTPEEKYQKEPPFHWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYTGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F I13V, K14R, E35D, M36I, R41K, K43KR, R57K, H69K, L89M  
>M41984| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVFEDINLPGKWRPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005