<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1415 1415 Rwanda 2011 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+NVP+TDF 55

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K14R, K20I, M36I, R41K, L63LP, I64IM, H69K, L89M  
>1415| codons 4-99
TLWQRPVVTVRIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIP
MEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184V A62AV K103N, Y181C   T39R, K46KQ, I47IL, K49R, D121H, K122E, I135T, E169D, D177E, T200L, Q207E, R211K, V245Q  
>1415| codons 38-247
CREMEKEGQLSRIGPENPYNTPVFVIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILDPFRKQNPEIVICQYVDDLYVGSDLEIGQHRLKIEELREHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Ndahimana, JD Drug resistance mutations after the first 12 months on antiretroviral therapy and determinants of virologic failure in Rwanda. Trop Med Int Health, 2016