<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F62040 F62040 U.K. 2001 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T 89
2 NVP+ 3TC+ D4T 19
3 NFV+ 3TC+ AZT 110
4 AZT+ ABC+ NFV+ 3TC 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12X, I15V, K20R, E35D, M36I, R41K, R57K, D60E, I62V, L63T, L89M  
>F62040| codons 1-99
PQITLWQRPVVXIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
QVTIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, T39TA, E40D, V60I, K64KR, I135T, E138EA, I142IT, S162H, K173IT, Q174K, I178IV, I202V, Q207E, R211EK, F214L, V245K, A272P, E291D, V292I, I293V, P294Q, E297T  
>F62040| codons 1-312
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPI
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNATPGTRYQYNVLPQGWKGSPAIFQHSMTKILEPFRIKNPDVVI
YQYMDDLYVGSDLEIGQHRTKVEELREHLLEWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVQLTTEAE
LELAENREILKE

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005