<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1425 1425 Rwanda 2011 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+NVP+TDF 51

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F L10V, I13V, E35D, M36I, R41K, R57K, L63I, H69K, L89M  
>1425| codons 4-99
TLWQRPVVTVKIGGQLKEALLDTGADDTVFEDINLPGKWKPKMIGGIGGFIKVKQYDQII
IEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E40D, K49R, I50V, V60I, V118I, D121H, K122E, I135T, T139A, I159IV, S162SDGN, K173S, Q174E, D177E, V179I, Q207A, R211S, F214L, V245Q Q145Q*
>1425| codons 38-247
CTDMEKEGKISRVGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLHEDFRKYTAFTIPSTNNEAPGIRY*YNVLPQGWKGSP
AVFQNSMTKILEPFRSENPEIIIYQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Ndahimana, JD Drug resistance mutations after the first 12 months on antiretroviral therapy and determinants of virologic failure in Rwanda. Trop Med Int Health, 2016