<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F73291 F73291 U.K. 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ NFV 195

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K11T, K20R, V21I, V35T, T39K, V60I, K122E, D123N, K173S, Q174K, D177E, V179I, T200A, I202V, Q207A, R211S, F214L, V245Q, E248D, T286A, E291D, I293V, P294T, E312D  
>F73291| codons 1-334
PISPIETVPVTLKPGMDGPRIKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYVDDLYVGSDLEIGQHRAKVEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L L33I, N83D L10V, I13V, A22V, E35D, M36I, R41K, I62V, L63PS, H69K, T74S, L89I, I93L  
>F73291| codons 1-99
PQITLWQRPVVTVKIGGQLKEVLLDTGADDTVIEDINLPGKWKPKLIGGIGGFIKVRQYD
QVPIEICGKKAIGSVLVGPTPVDIIGRNILTQLGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005