<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F87084 F87084 U.K. 2001 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ D4T 28
2 AZT+ NVP+ 3TC 15

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   G190A A98G P14A, V35T, T39A, E44ED, V90I, K122E, D123S, I135T, S162Y, K173L, Q174K, D177E, V179I, T200A, Q207E, R211S, V245E, D250E, A272G, I274IV, E291D, V292I, I293V, E312D, Y318X, Y319X  
>F87084| codons 1-324
PISPIETVPVKLKAGMDGPKVKQWPLTEEKIKALTEICAELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRLKNPEIII
YQYVDDLYVASDLEIGQHRAKIEELREHLLSWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYGGVKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKDPVHGVXXDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, G16E, E35D, M36I, R41K, R57K, L63V, H69K, L89M  
>F87084| codons 1-99
PQITLWQRPIVTVRIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005