<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F83733 F83733 U.K. 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ NVP 78

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   E6N, V35T, V60I, V90VI, K122E, D123S, I135T, T139X, S162H, K173A, Q174K, D177E, V179I, Q207A, R211S, V245E, D250Q, S251H, K281R, T286A, E291D, V292I, I293V, P294T, E312D  
>F83733| codons 1-334
PISPINTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNEXPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRAKNPEIII
YQYVDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKQHWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVTLTEEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, G16GE, E35D, M36I, R41K, H69K, L89M  
>F83733| codons 1-99
PQITLWQRPIVTVRIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005