<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M41971 M41971 U.K. 2001 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT 65
2 None 71
3 3TC+ AZT 58
4 AZT+ IDV+ 3TC 44
5 None 73
6 NVP+ NFV+ LPV 102
7 LPV+ NVP+ 3TC 35

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, M184V, T215F K219Q Y181I   E6D, T27S, V35T, T39A, V60I, K122E, D123S, I135T, E138A, I142IV, K173A, Q174K, V179I, Q207A, F214L, D218E, L228LH, V245M, D250DE, A272P, T286A, A288T, I293V, P294T  
>M41971| codons 1-334
PISPIDTVPVKLKPGMDGPKVKQWPLSEEKIKALTEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNATPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPDIII
IQYVDDLYVGSDLEIGQHRTKIEELRAHLLRWGLFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIMLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKTLTEVVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L10F, L33I T4TS, I13V, G16E, L19LI, K20R, E35D, M36I, N37D, R41K, K45V, K55T, R57K, L63H, H69K, K70R, L89M, T91TS  
>M41971| codons 1-99
PQISLWQRPFVTVKIEGQIREALLDTGADDTVIEDIDLPGKWKPVMIGGIGGFVTVKQYD
QIHIEICGKRAIGTVLVGPTPANIIGRNMLSQIGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005