<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M69708 M69708 U.K. 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ 3TC+ D4T 81
2 AZT+ NVP+ DDI 84

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215Y K219KE Y181C, G190A A98AG V35T, T39E, K43KR, S48T, T69X, K122E, D123DE, K173T, Q174K, D177E, I178IL, T200A, Q207X, R211K, V245Q, A272P, E291D, V292I, I293V  
>M69708| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEREGKITKIGPENPYNTPV
FAIKKKNSXRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPELVI
CQYMDDLYVASDLEIGQHRAKIEELRXHLLKWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, L19I, K20R, M36I, N37D, R41K, L63A, I64V, H69K, I93L  
>M69708| codons 1-99
PQITLWQRPLVSIKIGGQIREALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QIAVEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005