<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M55405 M55405 U.K. 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ NVP 237

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E, G190A   P4S, K11T, K20R, V21I, V35T, T39K, S68G, V90I, A98S, K122E, D123N, T165I, K166R, K173S, D177E, V179I, T200A, I202V, Q207A, R211K, V245Q, E248D, T286A, E291D, V292I, I293V, E297EA E312DY
>M55405| codons 1-333
PISSIETVPVTLKPGMDGPRIKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEIQLGIPHPSGLEKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIRILEPFRSQNPEIII
YQYVDDLYVASDLEIGQHRAKVEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, K20R, E35D, M36I, N37D, R41K, R57K, E65D, H69K, L89M  
>M55405| codons 1-99
PQITLWQRPLVTIKIEGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVKQYD
QILIDICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005