<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F92963 F92963-1 U.K. 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ EFV+ 3TC 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103KN, V106M, Y188YC V179VD, F227FL V35T, T39E, S48T, K122E, D123N, I135T, K173T, T200E, I202V, Q207K, R211A, V245Q, K259KR, A272P, K277R, T286A, E291D, V292I, I293V, D324DE  
>F92963-1| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSMTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPDIDI
YQYMDDLCVGSDLEIGQHREKVEELRKHLLAWGFTTPDKKHQKEPPLLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQRLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, M36I, R41K, L63X, H69K, L89M, I93L  
>F92963-1| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIXIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005