<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F26249 F26249 U.K. 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 283
2 3TC+ D4T 128
3 NFV+ EFV+ ABC 41
4 None 48
5 NFV+ EFV+ ABC 62

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K101E, Y181C, G190S   V35T, T69N, K102Q, K122E, D123G, K173T, Q174K, D177E, T200A, Q207E, V245Q, E248ED, D250E, A272P, K277R, E291D, V292I, I293V R172RI, D218DY
>F26249| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEQKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFITKNPEIVI
CQYMDDLYVSSDLEIGQHRAKIEELREHLLRWGFTTPYKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L89MV T12S, L19I, K20KR, M36I, R41K, L63A, H69K, I93L  
>F26249| codons 1-99
PQITLWQRPLVSIKIGGQIREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIAIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005