<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F65588 F65588 U.K. 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T 40
2 NFV+ DDI+ D4T 46
3 NVP+ DDC+ D4T 150

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181C   K11T, K20R, V21I, V35T, T39G, D123N, K173S, Q174QK, D177G, V179I, T200A, I202V, Q207A, R211S, H221Y, L228R, V245Q, E248N, A272P, T286A, E291D, I293V, P294T, E312N  
>F65588| codons 1-334
PISPIETVPVTLKPGMDGPRIKQWPLTEEKIKALTEICGEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPGIII
CQYMDDLYVGSDLEIGQHRAKVEELRAHLLSWGFTTPDKKYQKEPPFRWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKNPVHGVYYDPSKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, K45R, R57K, H69K, V82I, L89M  
>F65588| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005