<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F65692 F65692 U.K. 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI+ NFV 176

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y       V35T, E36A, T39EG, S48T, K122E, D123G, I135IV, E138A, K173A, D177G, T200A, I202V, Q207D, V245Q, L260V, A272P, K277R, T286A, E291D, V292I, I293V, L310LQ, K311R, E312N  
>F65692| codons 1-313
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPGIVI
YQYMDDLYVGSDLEIGQHRAKVEELRDHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKVVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREIQRNP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15IV, G16GE, L19T, M36I, R41K, H69K, L89M, I93L  
>F65692| codons 1-99
PQITLWQRPLVTIKVEGQTKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005