<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F51354 F51354 U.K. 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT 30
2 None 152
3 3TC+ AZT 38
4 AZT+ SQV+ 3TC+ DDC 36
5 D4T+ NFV+ NVP 79
6 None 11
7 DDI+ D4T+ EFV 109

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, K70KR, L74LV, T215F   K103N, Y181C A98G K11T, K20R, V21I, V35T, T39L, T69X, V106I, D123N, I135L, D177E, I178L, V179I, T200A, I202V, Q207A, R211X, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, P294T, E312G N57NI
>F51354| codons 1-334
PISPIETVPVTLKPGMDGPRIKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYITPV
FAIKKKNSXRWRKVVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSITVLDVGDAYFSVPL
DKNFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELII
CQYMDDLYVGSDLEIGQHRAKVEELRAHLLXWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKGPVHGVYYDPSKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K14R, G16E, K20T, E35D, M36I, R41K, R57K, L63T, H69K, I72T, T74TA, L89M  
>F51354| codons 1-99
PQITLWQRPVVTVRIEGQLTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QITIEICGKKATGAVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005