<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F61874 F61874 U.K. 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ IDV+ AZT+ 3TC 82
2 NVP+ IDV+ AZT+ 3TC 8
3 ABC+ DDI 113

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215F   Y181C   V35T, T39D, S48T, K49R, V60I, V118I, K122E, T139R, K173T, D177E, T200A, Q207E, R211K, F214L, H221Y, V245Q, D250E, A272P, K277R, Q278N, T286A, E291D, V292I, I293V  
>F61874| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICDELEKEGKITRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNERPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIVI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLFTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRNLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, M36I, N37D, R41K, D60E, H69K, L89M, I93L G17S
>F61874| codons 1-99
PQITLWQRPLVTIKIGSQIKEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYE
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005