<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F43587 F43587 U.K. 2001 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ DDI+ AZT 88
2 None 27
3 DDI+ NFV+ ABC 27

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R   Y181C   K20R, V35T, T39A, K49R, V60I, D121Y, K122E, I135T, T165I, D177E, I178V, G196E, T200A, E204K, Q207E, R211K, F214FL, V245Q, D250E, S251H, T286A, I293V, E297EA  
>F43587| codons 1-324
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICAEMEKEGKISRIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPEVVI
CQYMDDLYVGSDLEIEQHRAKIEKLREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKEHWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005