<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F46097 F46097 U.K. 2001 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 80
2 D4T+ 3TC 62
3 NFV+ DDI+ D4T 35
4 NFV+ DDI+ D4T+ NVP 35
5 NVP+ DDI+ D4T+ SQV+ RTV 78

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T4TP, I13V, K14R, Q18QH, E35D, M36I, R41K, R57K, L63P, H69K, L89M  
>F46097| codons 1-99
PQIPLWQRPLVTVRIGGHLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103KN   E6D, V35T, K49R, V60I, K122E, D123S, I135T, S162X, E169D, K173A, Q174K, D177E, I178L, T200A, Q207A, R211S, F214L, V245Q, D250E, A272P, K281R, R284RK, T286A, V292VL, I293V, P294PT, H315Q, V317I  
>F46097| codons 1-317
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQXSMTKILDPFRAKNPELVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLKGAKALTELVTLTEEAE
LELAENREILKEPVQGI

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005