<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F56326 F56326 U.K. 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC 117
2 AZT+ NVP+ DDI 54
3 ABC+ D4T+ 3TC 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K103N   K11T, V35T, T39R, K43KE, V90I, K102KR, V118VI, D121H, K122E, I135V, S162A, K173S, D177EG, T200A, I202IV, Q207D, V245Q, A272P, L283I, I293V, E312D  
>F56326| codons 1-334
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICRELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKRNKSVTVLDVGDAYFSIPL
HEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRSQNPEIVI
YQYVDDLYVGSDLEIGQHRAKVEELRDHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEVVPLTEEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, M36I, R41K, L63T, H69K, L89M  
>F56326| codons 1-99
PQITLWQRPIVTVKIEGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005