<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
C55937 C55937 U.K. 2002 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ SQV 77
2 3TC+ NVP+ AZT 146

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      K101N V35T, E40D, K49R, V60I, V90I, S162A, E204D, Q207E, V241I, V245Q, D250E, A272S, T286A, I329L, G333E I63IL
>C55937| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FALKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLNKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEDLREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
IQPIQLPEKESWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQEQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37S, R41K, I64V  
>C55937| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005