<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M81598 M81598 U.K. 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ NVP 48
2 IDV+ RTV+ D4T+ DDI 51

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14KR, I15V, M36I, N37K, R41N, H69K, L89M, I93L G52GV
>M81598| codons 1-99
PQITLWQRPLVTIRVGGQLKEALLDTGADDTVLEEIKLPGNWKPKMIGGIGVFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T27S, V35IT, E36A, T39E, S48T, K122E, D123S, I135T, K173A, D177E, T200A, Q207E, R211K, W212WG, F214FL, E224ED, L228LF, V245Q L12LF, K223KM
>M81598| codons 1-260
PISPIETVPVKFKPGMDGPKVKQWPLSEEKIKALIAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKGGLTTPDKKHQMDPPFFWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKL

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005