<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M49551 M49551 U.K. 2001 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 DDC 34
2 D4T+ NVP+ 3TC 146
3 RTV+ ABC+ DDI+ AZT 96

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DGNS, K70R, T215FI K219Q     K11T, K20R, V21I, V35T, T39E, K64KN, T69N, D121H, K122E, D123S, K173L, D177E, V179I, I202V, Q207A, R211KN, F214FL, V245Q, E248N, S251C, I293V E291V
>M49551| codons 1-297
PISPIETVPVTLKPGMDGPRIKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FAINKKSSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLQNPEIII
YQYMDDLYVGSDLEIGQHRTKVEELRAHLLNWGLITPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDCWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTVVVPLTE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T4TP, I13V, G16E, E35D, M36I, R41K, H69K, L89M  
>M49551| codons 1-99
PQIPLWQRPLVTVKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005